Query Sequence
>3610439
MGQADPDPLFAFLCRMGDNTLVLGHRVSEWCGHAPVLEEDIALANTALDLIGQTQMWLGHAGAVEGKGRSADDLAMLRDVWDFRNLLLVEQPNGDFGQTMMRQFLFDAWHLQMLRALTGSSEPQVAAIAAKSVKEVQYHLERSGEMVIGLGDGTAESHGRMQAALDLLWPYVGEMFQPDPVDRAMAAAGIAPDPSGLRAGFDAHVDAVLAEATLSIPEGGFAQTGGKTGFQHSEHLGHMLTQMQWLQRAYPGARW
Hit FamilyFIG00001825
Hit Family FunctionPhenylacetate-CoA oxygenase, PaaI subunit


back to search