Query Sequence
>3610414
MTKQDTSGAVLSAHNLVKHFPLGGWGKNRRVVRAVDDVTFEVAPGETLGVVGESGCGKSTTARLLVQLLGADSGEVRFQGHVAGTEMPLKEFRRHVQMVFQDSYASLNPRMSMLDAIAFGPTVHGVSEAEAQRIARDLLDRVGLDPSRFGPRYPHELSGGQRQRVNIARALAFQPEVIVLDEAVSALDKSVEAQVLNLLMDLKRERNLTYVFISHDLNVVRHVSDRVMVMYLGEVAEIGPTAEMYADPRHPYTRALLAAMPSLDPDRRTTEAPLSGDPPNPIDPPSGCRFHTRCAEAFGACSAQRPSNLRVGAGHYASCHLNDPKMREAAA
Hit FamilyFIG00018865
Hit Family FunctionOligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)


back to search