Query Sequence
>3610174
MADNSSTNAYWAANIRIITWCLVIWAVASYGFAILLRPLLSGIPIGGTDLGFWFAQQGSILVFLALIFFYAWRMNKLDKEFGVEE
Hit FamilyFIG01200112
Hit Family FunctionFIG152265: Sodium:solute symporter associated protein


back to search