Query Sequence
>3609760
MRDNTLKYFLVLPAVVVVFATAIWPLIEAARMSFTVGRLNRPGSLEQYIGWENYAWAFFEEPAFWNSVYVTALYTVVTVGLTTLLALGLALLLAPGGRLRVSAQTLLILPFAMSPALIGVSFRFMFNPEFGLFDAFFGVMIPPLADVSWLADPTLAFAVVVMADVWGWIPFLTLVLIGGLASVPRDTIEAAQVDGASSWRVFRDVTLPQLGPVLAVVIILKSIFSLKTFDQVFMLTNGGPGTATQTLSHYIYFNGMKYGQIGYSASVAWLMVIPMIFLTYAYAKFVFRKN
Hit FamilyNo hits found for this sequence


back to search