Query Sequence
>3609462
MDFATLLQVLDSTIRLATPLLLACLAGLFSERAGIFDIGLEGKMLVAAFLSAAMAAITGSVWIGLFAGVFAALLFSAIHGLASITFRGNQLISGVALNFLAAGLTVLIAQSWFSQGGRTPSLIGGARFEPITLPFAEALQNVPILGPIYYELISGHTILVYVALLAVPATWYILFRTRFGLRLRAVGENPAAVDTAGISVVGLRYAAVAICGLLCGLAGAYLATGLSAGFVKDMTAGRGYIALAALIFAKWRPWYALMACLLFGFLEAIANRFQNIEILSIPIPVQLMQALPYILTVVILAGFVGKAIPPRAGGEPYVKER
Hit FamilyFIG01304391
Hit Family FunctionPredicted nucleoside ABC transporter, permease 2 component


back to search