Query Sequence
>3609458
MTILQKLLGATGALALSTGAALAEPALIFDLGGKFDKSFNEAAFNGAQRWVQETGGTYREIELTSEAQREQALRRFAEAGNNPIVMTGFAFGNVLGEVAPDYPDTSFAIIDMVVDQPNVRSVVFNEHEGSYLVGMMAAMASETGTVGFIGGMDIPLIRKFACGYAQGVKAANPDATVIQNMTGTTPAAWNDPVKGGELTRAQISQGADVVYAAAGGTGVGVLQTAADEDILSIGVDSNQNYLHPGEVLTSMMKRVDNAVFAAMSDGPGFETGIRVLGLAEDGVGYALDEFNAELVTDEMQAAVEEAKAKIIAGEITVHDYMSDNTCPVM
Hit FamilyFIG00138542
Hit Family FunctionPredicted nucleoside ABC transporter, substrate-binding component


back to search