Query Sequence
>3609413
MILCAGEALIDMLPRALPDGTAGFAPVAGGAVFNTAVALGRLGADVGLVTGLSRDLFGEVLMTALAAADVDSDMAVLSDRPTTLAFVTLTDGHAQYAFYDENTAGRMLAPADMPDPGPEVGTLFFGGISLAVEPCAAAYEALCLKAAAGRVVMLDPNIRPGFIKDETTFRARIDRMLAVTDIVKVSDEDLAWLMGPGDLAESAAALRARGPAVVCVTRGGAGVEAHTATGITHVAAEAVEVVDTVGAGDTFNAGFLAGLAEAGALDKDRLRALDAPVLTSALRLGAQAAAITVSRAGANPPWRDELPR
Hit FamilyFIG00001653
Hit Family FunctionFructokinase (EC 2.7.1.4)


back to search