Query Sequence
>3609389
MGKTGEEWGFPADRLWQVAEALAQAARGPTLAQFRQHGLGIENKAGVAAFDPVTEADRAAERAMRDLLAVERPDDGILGEEYGAQAGTSGLTWVLDPIDGTRAYMSGTPTWGVLIALSDRDGPRIGIIDQPYTAERFMGGAGRARLDGPHGSLPLATRRVAGLSEATVFTTFPEIGTAAERAGFEAVARVCRLTRFGMDCYAYGLLAAGQIDLVIEAGLQPYDICAPIAVIEAAGGIVTDWQGGPAHGGGRVLAAGGPEVHAAALEILRKVPA
Hit FamilyFIG00001748
Hit Family FunctionHistidinol-phosphatase [alternative form] (EC 3.1.3.15)


back to search