Query Sequence
>3608652
MRMTTEEAFIKVLQRHGVDHAFGIIGSAMMPISDLFPEAGITFWDCAHEGSAGMMADGFTRASGRMSMMIAQNGPGITNFVTAVKTAYWNHTPLLLVTPQAANKTIGQGGFQEVAQMKLFEDMVAYQEEVRDPSRMAEVLTRVISKAKTLSGPAQINIPRDFWTQVIDIEIPEPIEFERSPGGEASVARAAALLSEAKNPVILNGAGVVLSEGGIAASKALAERLDAPVCVGYQHNDAFPGGHPLFAGPLGYNGSKAAMELISEADVVLALGTRLNPFSTLPGYGMEYWPADAKIIQVDINSDRIGLTKKISVGIVGDAAKVARGILGQLAEDAGDAGRQERRDRIAQVKSRWAQQLSAMDHEEDDPGTTWNARARAAKPDWMSPRMAWRAITAALPRDAIISSDIGNNCAIGNAYPDFDAPRKYLAPGLFGPCGYGLPAIVGAKIAQPDTPVVGFAGDGAFGIAVNELTAIGRGDWPAITQVVFRNYQWGAEKRNSTLWFDDNFVGTELDEEVSYAGIARACGLDGVVVRTMQELTDTLATAIKAQMTEGKTTLIEVLLNQELGEPFRRDAMKKPNKVAGVSKQDMMVEAG
Hit FamilyFIG00884086
Hit Family FunctionSulfoacetaldehyde acetyltransferase (EC 2.3.3.15)


back to search