Query Sequence
>3608366
MTPSEASAQAREICGLAPVIPVLVIHDLAHARPLAEALVAGGLPALEVTLRTPVALDAIAEMAQVEGGVVGAGTLLTPEDVAAAKAAGALFGVSPGATSRLLDAAEAADLPMLPGAATSTEVMALLERGYTVQKFFPAEANGGAPALKSIGAPLPQVAFCPTGGVSLANAPTYLGLGNTLCVGGSWVAPQAMMEAGDWAGITELAAEAAALPR
Hit FamilyNo hits found for this sequence


back to search