Query Sequence
>3608365
MSSICVFCGARAGLTPSHTDTAEALGRWLAEAGHRLVYGAGDVGLMGSVARAAQQAGGDTFGVIPAHLLDLEVGKTDLTRFVVTETMHERKKVMFANSDAIVVLPGGAGSLDEFFEVLTWRQLGLHAKPILLLNVDGYWTPLLALIDHVIAQGFAAESLRGFITVCADLQAVQAALGPA
Hit FamilyFIG01349038
Hit Family FunctionLysine decarboxylase family


back to search