SEED Viewer version 2.0

Welcome to the SEED Viewer - a read-only browser of the curated SEED data.
For more information about The SEED please visit theSEED.org.
For daily updates on SEED activity visit the Daily SEED

»Navigate Startpage Organisms Browse Subsystems Curate Subsystems Scenarios FigFams BLAST Search Visit the Daily SEED Request a Subsystem »FIGfam Home Download »Help What is the SEED HowTo use the SEED Viewer Submitting Data to SEED Contact Register I forgot my Password

Query Sequence	>3608365 MSSICVFCGARAGLTPSHTDTAEALGRWLAEAGHRLVYGAGDVGLMGSVARAAQQAGGDTFGVIPAHLLDLEVGKTDLTRFVVTETMHERKKVMFANSDAIVVLPGGAGSLDEFFEVLTWRQLGLHAKPILLLNVDGYWTPLLALIDHVIAQGFAAESLRGFITVCADLQAVQAALGPA
Hit Family	FIG01349038
Hit Family Function	Lysine decarboxylase family

back to search