Query Sequence
>3608030
MHGDTVIEISNVWKIFGANAQAALEAVRDRGLSKAEILAEFNAVVGVADVSLSVRRGEIFCIMGLSGSGKSTLVRHFNRLLEPTAGRIEIEGTDVMALGTQELQRFRNRQIGMVFQNFALMPHRSVLDNVAMPLEIRKVPKNERMRQAAAILDIVELGAWGAKFAHELPGGMQQRVGLARALAANPDVLLMDEPFSALDPLIRRQLQDEFIRLSKILKKTTIFITHDLDEAVRIGDRIAIMRDGKVVQMGTAEDIVMHPADDYVADFVAGISRLKVVHAHAVMQPLEAYLATHGPLPAAVPKVDEGETLSNLITLAIDDENPILVQDAGRDVGIITRADLLRTVIEGTEVS
Hit FamilyFIG00008556
Hit Family FunctionL-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)


back to search