Query Sequence
>3607892
MKLNTNWVAGTSEGAANRAAHLAALAQVSQVAALAAAGGGEAARARHVARGKMLPRDRVANLLDPGSPFLEVGATAGHGLHDGAAPCGGAIAGVGRVHGQDVMVVCNDATVKGGTYYPITVKKHLRAQEIAAECHLPCIYLVDSGGANLPNQDEVFPDRDHFGRIFYNQARMSAAGIPQIAVVMGSCTAGGAYVPAMSDVTIIVKAQGTIFLAGPPLVKAATGEVVSAEDLGGGDVHTRLSGVADALAEDDAHALALARQAVASLNRAAPSSVVWQSPEAPAYDPEELLELVPASLSVPYDIHEVIARIVDGSRFDAFKPRFGETLVTGFAHIEGCPVGIVANNGVLFSEAAQKGAHFVELCSQRKIPLVFLQNITGFMVGRQYENEGIARHGAKMVTAVATTAVPKITMVVGGSFGAGNYGMAGRAYQPRFMWSWPSSRISVMGGAQAAGVLATVKRDAIERKGGSWSAQEEAAFKQPTIEMFEAQSHPLYASARLWDDGIVDPRKSRAVLSLSLRAALNAPIEETRFGVFRM
Hit FamilyFIG00138249
Hit Family FunctionMethylcrotonyl-CoA carboxylase carboxyl transferase subunit (EC 6.4.1.4)


back to search