Query Sequence
>3607850 Dshi_1258 short-chain dehydrogenase/reductase SDR (RefSeq)
MSQTPLALITGGAQGIGYACAEALAAEGARIILADIQDSVQEAAARLGGAGYLCDMGDAAAVGALFDRIEAEHGAVTYLVNNAGIAAPGDFLDYDLATFDRVLDINLRGVFVATQRAGRSMVAHGIKGAVVNMSSINAQVAIPSIPAYCASKGGLMQLTKVAALALAPHGIRVNAVGPGSIDTEMMAGVNANPEAMNMVLSRTPLKRVGTAQEIANVVAFLCSDKASYVTGETIYVDGGRLGLNYTC
Hit FamilyFIG00621114
Hit Family Function


back to search