Query Sequence
>3607832
MSATLYDDRPCALGEGPLWHPERQQLFWFDITGQRMLSRDGDTPLEWQFDEMVSAAGWVDHDTLLIASETALVTFDLAEGESRFVAPLEADRPETRSNDGRADPWGGFWIGTMGKSAEPGAGAIYRLFDGTLRRVVRDVTISNALCFDAAQSCAYYADTPTRQVMRLPLDGDGWPSGPATVAVDLRAEGLNPDGAVTDAAGNLWIAQWGAGRVACHAPDGTFLRALACGGRHSSCPAFGGPDLDQLFITTAREGLSADDIAAAPENGCVFAAEGVARGLPEPRVIL
Hit FamilyFIG00991388
Hit Family Function1,4-lactonase (EC 3.1.1.25)


back to search