Query Sequence
>3607821
MSRPVVGIIGNSYLINDEYPAHAGGSMNSCAVSKVAGAIPFIVPTDPTLVSVDELLEVCDGFVLTGARANVHPEEYGHQPTDKHGDFDRDRDRITLPLVRACVERGQPFLGICRGFQEVNVAMGGTLHPEIRELPGRINHRMPPEGTLEEKFEIRQTVTVSPGGPFARVFGATQVRTNTLHGQGIMDPGTRVVIDGHAEDGTPEAIYIADAPGFTLSVQWHPEWNADRDPVSRPLFTAFGEAVRAWADGRRPVAVARSA
Hit FamilyFIG01343149
Hit Family Functionglutamine amidotransferase, class I


back to search