Query Sequence
>3607390
MEADYVVIGAGSAGCVVANRLSTDARNKVVLLEAGPPDTNPWIHIPVGYFKTMHNPTVDWCYKTQADPGLNGRSIDWPRGKVLGGSSSLNGLLYVRGQPEDYDRWRQMGNAGWGWDDVLPLFRRAEANERGADPWHGDDGPLAVSNMRIQRPICDAWVAAAQAMGYPFNPDYNGASQEGVGYFQLTTRNGRRCSAAVAYLKPARKRPNLSIITRALVTRIEMEGKRVTGVTYTDAGGRAHTVSARREVILSGGAINSPHILMLSGIGDPDQLQAHGITPRHALPGVGKNLQDHLQARLVFKCNEPTLNDEVRSLVNQARIALKYALFRAGPMTMAASLATGFLKTRPDIATPDIQFHVQPWSADSPGEGVHPFSAFTMSVCQLRPESRGEIRLAGPDPRTYPTIHPNYLSTETDCATLTEGVKIARRIARADPLAGKIAEEFRPPANLALDDDAATLDWARSNSVSIYHPTGTCKMGTGPGAVVDARLRVHGLSGLRVADCSIMPEIVSGNTNAPAIMIGEKLSDMVLEDARDTAQAVPA
Hit FamilyFIG00057416
Hit Family FunctionCholine dehydrogenase (EC 1.1.99.1)


back to search