Query Sequence
>3607097
MNGLQKSFGKNNVLRGIDLTLDPGSVTVLMGANGAGKSTLVKVICGQHRADGGTMRLATNAFDPEDAADAIRQGVVTVHQSIDDGVIPDLDVANNLMLDRLAEHSHGLFVRERHLRTEAAKVAAAMGIEVNLRARVSDLSVADRQMIAIARAMARAPKVLILDEPTSSLSATEADRLFELIDRLRAQGVAILYISHRMSDIRRIADRIVVMRDGMISGVFETEPLDLEAAVTAMLGHRMTEVDAEVRQGTHPVLEIKNLQLFEGASPITLTAHDGEVVALVGLLGSGKSRLAEILFGIARPIRGSIRIKGKDYSPRSVKDAIAQGVFMSPKDRGTNAVIPAFDIADNMTLPFLQGMSVGSFLKSRQQRGTAQGMVDRLGIVCQSVRDGIGTLSGGNQQKVMIARWLLEPAQVLLLDEPFQGVDIGARRDIGHHIRATTQGRATLVFLAEIDEALEIADRIVVMSEGAIVGEHTNRNIDLAALVADISGATSTVTGTSP
Hit FamilyFIG00018457
Hit Family FunctionRibose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)


back to search