Query Sequence
>3606958
MMHTAYTLGLPQPCTTSVIFASPHSGRAYSKDFLRSTVLDTQTIRSSEDAFVDELIACAPRYGAQTIAATAPRAYIDLNRNADELDPAVVSGLRRVTHNPRISSGLGVVPRVVANGRAIYRGKMHLNEAKARLDAYWHPYHDQLRRMLDVTRNAFGQAILVDCHSMPHEAIDALHQHSEARPDVVLGDRFGAASAAHIVDQVEAAFKNAGLRVARNAPFAGAFIAQHYGRPSRNQHVVQIEIDRALYMDEETISRGPQFRAFQRLMEQVISEVADFGRASQMPLAAE
Hit FamilyFIG00001559
Hit Family FunctionN-formylglutamate deformylase (EC 3.5.1.68)


back to search