Query Sequence
>3606921
MTDAVSRAAQVLAEHRDSIDRLDAILVFTLAERFKHTQAVGRLKAEHALPPSDPTREESQIKRLSELAEMADLDPDFAKKFLNFIIQEVIQHHKQHQS
Hit FamilyFIG00001498
Hit Family FunctionChorismate mutase I (EC 5.4.99.5)


back to search