Query Sequence
>353166
MIKLEGITKSFGSLQVLKGIDLEINKGEIVSIVGPSGAGKTTLLQIMGTLDEPDAGTVAIDGTVVSRMKEKELSAFRNKNIGFVFQFHQLLPEFTALENVMIPAFIAGVSSKEANERAMEILAFMGLTDRASHKPNELSGGEKQRVAVARALINHPAVILADEPSGSLDTHNKEDLHQLFFDLRDRLGQTFVIVTHDEGLAKITDRTVHMVDGTIKKD
Hit FamilyFIG00000771
Hit Family FunctionLipoprotein releasing system ATP-binding protein LolD


back to search