Query Sequence
>353113
MLSTINETYLFQQDLLTVKMFPSIQQMGKCAATEVTNKICELLKEKAEINMIFAAAPSQNEFLSHLIHSKQIDWSRINAFHMDEYIGIHPEAPQSFGNFLRQRIFDKVPFKTVNYLNGQAENLEEECKRYSELLLRHPVDIVCLGIGENGHIAFNDPDVANFNDSHLVKVVELDPICRQQQVNEKCFEAFDLVPAKALTLTIPALLKADWMFCIVPFKNKANAVYNTLYGEISEKCPASILRKKENSCLYLDPESAERINL
Hit FamilyFIG00000645
Hit Family FunctionGlucosamine-6-phosphate deaminase (EC 3.5.99.6)


back to search