Query Sequence
>352867
MKKQLLSCCLAALGLTTAIQAQNFNEWKDPEVNSVNRSAMHTNYFAYASADEAKAGSKEDSQNFMTLNGLWKFNWVRNADARPTNFYQTSFNDKGWDNIKVPAVWELNGYGDPIYVNVGYAWRNQFQNNPPLVPTENNHVGSYRKEIVLPADWKGKDIFAHFGSVTSNMYLWVNGRYVGYSEDSKLEAEFDLTNYLKPGKNLIAFQVFRWCDGSYLEDQDFFRYSGVGRDCYLYARDKKRIQDIRVTPDLDSQYKDGTLNIAIDMKGSGTVALDLTDAQGKSVATADLKGSGKLNTTINVANPAKWTAETPNLYTLTATLKNGSTVTEVIPVKVGFRKIELTGGQILVNGQPVLFKGADRHEMDPDGGYVVSLERMIQDIKVMKQLNINAVRTCHYPDDNRWYDLCDQYGLYVVAEANVESHGMGYGDKSLAKNPIYAKAHMERNQRNVQRGYNHPSIIFWSLGNEAGMGPNFEHCYTWIKNEDKTRAVQYEQAGTSEFTDIFCPMYYDYNNCIKYCEGNIDKPLIQCEYAHAMGNSQGGFKEYWDITRKYPKYQGGFIWDFVDQSCHWKNKDGVAIYGYGGDFNKYDASDNNFNDNGLISPDRVPNPHAYEVGYFYQNIWTTPADLSKGEINIYNENFFRDLSAFYLEWQLLANGEIIQNGIVSDLNVAPQQTAKLQLPFDIKNICSCKELLLNVSYKLKAAETLLPAGETIAYDQMSIRDYKAPELKLENKQSSNIAVVVPSFQDNDHNYLIVSGEDFTLEFNKHNGYLCRYDVSGTQLMEDGSALTPNFWRAPTDNDFGAGLQHRYGAWKNPELKLTSLKHDIENEQAVVRAEYDMKSIGGKLFLTYAINNKGAVKVTQKMEADKSKKVSDMFRFGMQLRMPVTFNEIEYYGRGPGENYSDRNHAARIGKYRQTVEEQFYPYIRPQETGTKTDIRWWRLLNIGGNGLQFVADAPFSASALNYTIESLDDGAGKDQRHSPEVEKANFTNFCIDKVQTGLACVNSWGAIALEKYRLPYQDYEFSFIMNPVYHKLK
Hit FamilyFIG00001548
Hit Family FunctionBeta-galactosidase (EC 3.2.1.23)


back to search