Query Sequence
>352759
MNQYLNFSLKGKVALVTGASYGIGFAIASAYAEQGATVCFNDINQELVDKGMAAYAEKGIKAHGYVCDVTDEPAVQAMVATIEKEVGTIDILVNNAGIIRRVPMHEMEAADFRRVIDIDLNAPFIVSKAVLPAMMKKRAGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNICSEYGEYNIQCNGIGPGYIATPQTAPLREKQADGSRHPFDSFICAKTPAGRWLDPEELTGPAVFLASEASNAVNGHVLYVDGGILAYIGKQPK
Hit FamilyFIG00043852
Hit Family Function2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)


back to search