Query Sequence
>352713
MKYQVIIIGGGPAGYTAAEAAGKAGLSVLLIEKNNLGGVCLNEGCIPTKTLLYSAKTYDSARHSSKYAVNVSEVSFDLPKIIARKSKVVRKLVLGVKAKLTSNNVAMVTGEAQIIDKNTVRCGEETYNAENLILCTGSETFIPPITGVETVNYWTHRDALDSKELPASLAIVGGGVIGMEFASFFNSLGVQVTVIEMMDEILGGMDKELSALLRAEYAKRGIKFLLSTKVVALSQTEEGAVVSYENAEGKGSVIAEKLLMSVGRRPVTKGFGLENLNLDKTGRGAIKVNEKMQTSLSGVYVCGDLTGFSLLAHTAVREAEVAVHSILGKEDAMSYRAIPGVVYTNPEIAGVGETEESASAKGITYKVVKLPMAYSGRFVAENEGVNGVCKVLLDEQERIIGAHVLGNPASEIITLAGTAIELGLTAAAWKKVVFPHPTVGEIFREAL
Hit FamilyFIG00136193
Hit Family FunctionDihydrolipoamide dehydrogenase (EC 1.8.1.4)


back to search