Query Sequence
>349991
MKGIVLAGGSGTRLYPITKGVSKQLLPIFDKPMIYYPISVLMLAGIREILIISTPYDLPGFKRLLGDGSDYGVHFEYAEQPSPDGLAQAFIIGEEFIGNDSVCLVLGDNIFYGQGFTHMLKEAVHTAEEENKATVFGYWVADPERYGVAEFDKIGNVLSIEEKPIQPKSNYAVVGLYFYPNKVVEVAKNITPSSRGELEITAVNQQFLNDQELKVQLLGRGFAWLDTGTHDSLSEASTFIEVIEKRQGLKVACLEGIALRHGWITTDKMRELAQPMLKNQYGQYLLKVIDELTQK
Hit FamilyFIG00000187
Hit Family FunctionGlucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)


back to search