Query Sequence
>349874
MKTIGLACDHAGFELKEYVRGWLEVKGWAYKDFGTNSAASVDYPDYAHPLALAVESGECYPGIAICGSGNGINMTLNKHQGIRAALCWNAEIAHLARQHNDANILVMPGRFISTEEADMILTEFFSTQFEGGRHQNRIDKIPVK
Hit FamilyFIG00134342
Hit Family FunctionRibose 5-phosphate isomerase B (EC 5.3.1.6)


back to search