Query Sequence
>349839
MSRFEIKMPKLGESITEGTIVSWSVKVGDVIQEDDVLFEVNTAKVSAEIPSPVAGKVVEILFKEGDTVAVGTVVAVVDMGGEEASDEETASGKETPESKENASSDAEKVSSQVAKAEERWYSPVVIQLARGANIPKEELDSIQGTGYEGRLSKKDIKDYIEKKKRGISEVSKAAIPTGDALTASMPSSTGGAGSMTTSPVAASVQTPVAAPSAPSKQAPAAANIPGVEVKEMDRVRRIIADHMVMSKKVSPHVTNVVEVDVTKLVRWREKNKDAFFRREGVKLTYMPVITEAVAKALAAYPQVNVSVDGYNILFKKHINIGIAVSLNDGNLIVPVVHDADHLNLNGLAVAIDSLALKARDNKLMPDDIDGGTFTITNFGTFKSLFGTPVINQPQVAILGVGYIEKKPAVIETPEGDTIAIRHKMYLSLSYDHRVVDGMLGGNFLHFIADYLENWKG
Hit FamilyFIG00001753
Hit Family FunctionDihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex (EC 2.3.1.-)


back to search