Query Sequence
>209486
MRKGWFKALIAGMTVAVMAGPVFAGDTIKLGVPGAHSGDLASYGLPSANAAKIVAKMFNDKGGINGKMVEVIPQDDQCKPEMATNAATKLVSDGVDIVLGHICSGATKAALPIYKEANKVVMSPSATTPALTQSGDYPMFFRTISSDDQQAKLGVDFAIDKLGAKKIAVLHDKGDYGKGYAEYAKQFIEQSGKATVVLFEGVTPGAVDYSAVVQKVRSEGADAVMFGGYHPEASKIVAQMRKKRMTTPFISDDGVKDDTFIKVAGKDAEGVYASSSKDVSMLPMYKEAIELHKKEFGTEPGAFYKEAFAAAQALLTAVQRAGSTETPKVVDALRNNFVETAIGKIKFDKRGDAEGTGFSMYQVKNGVYVELK
Hit FamilyFIG00055715
Hit Family FunctionBranched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)


back to search