Query Sequence
>209431
MLNKPRLLTPGPTPLPERVRLVMAQDMIHHRKPAFKKLMGEVQEKLRILFGTSQPVLPLACSGSGAMTAAVHGLFVPGEKVIVVEGGKFGQRWREIASLRGLEVVSIVVEWGRAVSLAEVEAALDAHPDAKGVLMQLSETSTGVLHPVRGIAAVTRKRDVLLVADGISAVGISPCPMDEWGVDCLLTGSQKGLMLPPGLALIALSERAWRKADTVAPSCFYFNLPGERANCEKGQTLFTTPVSLIVGLGESLDMFLEAGLETVYRKQWALTMLARAGTAALGLAPLAPERFTWGLTSVMLPAGVDGTRLLQVAADNHGVVMAGGQDHLKGRILRIGHMGWVDWADIVAGLHAVASGLRTCGAYVGARDYIETGLAAYEAALQVAPGTPV
Hit FamilyFIG00001504
Hit Family FunctionSerine--glyoxylate aminotransferase (EC 2.6.1.45)


back to search