Query Sequence
>209090
MQPVLRPIGTVRSRLTRLDDCPKNGDEGAPEAWIDILPEFAAGLDTLEAGQELTLVTWLHLADRDTLAVHPRGDTSRPMRGVFNTRSPARPNPLGLHDVRLLGTAPGPDGMVRLLVAPLEALHGTPVVDIKTSLSQRRDTGWGDGVPLREAETVRRLCHTAWQRGLLSGFNGNVSLRLGATCLVTCTGAAKGDLSPGDLAVVDIASGKRIAGGKPSSELAMHLEVYRRQPRAQAIVHTHPPRLLALGLRVAPQQMLHIDVYEAQMLVSRLGSAPAHAPGTQALADAVGEAAVTREAVWMERHGLVCWGETPMQALALGEELEHLAGIHLSVL
Hit FamilyFIG00001872
Hit Family FunctionCOG1720: Uncharacterized conserved protein


back to search