Query Sequence
>208684
MKQTNIYDSRGLARALDTTAAWTLAIMWALPLLYAIWTAFHPSAYSTRFTLNAPLTLENFVTAWHAAPFALYFVNTVLLVTMVLAAQLVLCTLAAYAFAKYDFRGKNIMFALVLMQLMIMPDVLVVENYRTMASIGVLDSTLAIGLPYMASAFGIFLLRQTFKSIPKELDEAAAVEGASTLQILWKVYVPLGKPVYLAYALVSISYHWNNFLWPLIVTNTTNSRPLTVGLQVFSSTEQGVDWAIITAATLMTSGPLLVAFLLFQRQFVQSFMRAGIK
Hit FamilyFIG01431311
Hit Family Functioninner membrane component of binding-protein-dependent transport system


back to search