Query Sequence
>208241
MEFFDIAETWNRDEIRQAQLVRLRNTVEQAMRSSFYGATLRKAGITPDSIRSLDDLRRIPFTTKDDLRNQYPDGLNCVPRTEMVRMHASSGTTGSPTVVYHTQSDLNAWADLMARCLHMVGVRRDDVFQNMTGYGLFTGGLGLHYGAERLGCLTIPAGPGNTKRQVKLMRDFRTSVVHIIPSYALYLAAAVEEGGEDPHALPPRIAVIGAEPHTEEARRRIEEMLGLKAFNSYGLSEMNGPGVAFECTEQNGMHVWEDAYIAEIIDPATGEPVPDGEVGELVMTTLCRRGMPVLRYRTRDLTRFLPGECPCGRVHRRLDRMVGRADDMLIIKGVNIYPMQIEQVLMAFPEVGQNYLIVLEREEFIDQIKVKVELRDEAFVEDMRVLQGLQKAIARRLKDEILVTPRVELVQNNSLPKAEGKAQRVLDLREKP
Hit FamilyFIG00001094
Hit Family FunctionPhenylacetate-coenzyme A ligase (EC 6.2.1.30)


back to search