Query Sequence
>207987
MITIDLHTHTSHSHGQATVQEMFEAGCARGLLVHGFSEHSPRPSGYDYPKDYRDKLTRSFPDYVEQVRTLAATYAPERTVLLGLEMDWLPGQEPFIDATIHRYDYDYVIGGIHFLGTWGFDYTPDDWQGFSPEQTADIYVRYFESLRRMAASGMFDIAAHPDIIKIFSAAAFHDWLATDKAKAVVRDALETMHTAGMAMEISSAGLRKPCKEIYPCPDIMRMAADIGLPVTFGSDAHCVNTIGWGFDTLADYARGFGYTRSVWMRRGERFERPF
Hit FamilyFIG00229257
Hit Family FunctionHistidinol-phosphatase (EC 3.1.3.15)


back to search