Query Sequence
>207827
MQWDVVWNNMNYLLVGSYPDGPLGGMAMSILLAIGGIFGAFWLGLAFGLMRLSEKWWVRAPAIVYVEVIRGIPLLMLIFWFYFLAPIALGHTLPEAESALIAFIVFTGAYIAEIVRAGVLALPAGQMEAARGTGLSKTQAMLFVILPQALRNMIPSFVNQFVSLTKDTSLAYIIGVSELTRTATQVNNRTLTAPTEIFLTIALMYFVICWVLTATSRRLEKQMARYQART
Hit FamilyFIG01220819
Hit Family FunctionABC-type amino acid transport system, permease component


back to search