Query Sequence
>207079
MMAVLQGEDLRKRFGQREVVRGVSVSVQQGEIVGLLGPNGAGKTTTFYMLTGIIKPTAGIVRLDGQDIADWPLHERARVGLSYLPQESSVFKRLTVRENLEIILEHTGLPAARQKERAEALMADFGIAHLASSRAMHLSGGERRRLEIARCMIREPKFVLLDEPFAGIDPLAVGDIQGLIRKLRDRGIGVLISDHNVRETLTICDRAYLVHQGQVILDGTPEHIVGDEQARLVYLGADFCL
Hit FamilyFIG00002720
Hit Family FunctionLipopolysaccharide ABC transporter, ATP-binding protein LptB


back to search