Query Sequence
>207020
MTTTIESLGTFETSWCPGCGNHDIMKALRQAIVGLGLEAHKVAHVSGIGQAAKAPHYIRLNGFNGLHGRSLPPAQAIRLCNSELTVIAQSGDGCNYGEGGNHFLAAIRRNVDMTLLVHDNQIYGLTKGQASPTTGEGQVTKSQPGGVTSAPFNPVAVAVAMRCGFVARSFSGNVEHLQAMIEAAVRHRGFSLVDIFSPCVSFNKVNTFGWYRQRCREIDASHDPTDWNAAMRIADTFGDVLPIGVIYRNERPPLDERVSHVAKGPLGRQAVRHDVLRDIMASYM
Hit FamilyFIG00049580
Hit Family Function2-oxoglutarate oxidoreductase, beta subunit (EC 1.2.7.3)


back to search