Query Sequence
>206677
MLQKVLLTVAALLLSTNVAFAERTVVFAHDATWPPMEFVDANKQIVGLAVDYVDAIAKEAGFKVVHKNVAWDGIFAGLAAGKYDAIASSVTITEERKKAMDFTMPYFDVKQALVVPKTTEAKTLEDMKGKTLGAQISTTGHFAIKRTAGVTAKSYDEIGLAMEDLFNGRIDGVVCDDPVAANYALQQEEYAKKLKIAFIVDTPESEYYGIAVKQGNKELVDLINKGIEAVKAKGIDAQLRAKWIGR
Hit FamilyFIG00986227
Hit Family Functionamino acid ABC transporter, periplasmic amino acid-binding protein


back to search