Query Sequence
>206139
MISRKASYAGLAVLIAVLPLFLDPYWTDVCVSIGLYAVLALSLNLILGQAGLFHMGHAAFYAVGAYTAAILNTVYHVPVLWTMPVAGLLAALFALVVARPIIHLRGDYLLIVTIGIVEIVRIALINNVFGITGGANGIFGISRPMLFGYKISKPIQFYYLIWTWVAISILLFRRLECSRFGRALNYIKEDDVAAEGSGVDTAYYKLAAFVLGALWAGMTGTFYAAKMTIISPESFSFWESVVLFAIVILGGGSNRGVLLGAFLLIGLPELFRDFASARMLIFGLAMVVMMIFRPQGMLPPLPRKYRIDNLLRTKEAA
Hit FamilyFIG00005172
Hit Family FunctionBranched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)


back to search