Query Sequence
>203460
MNNRVLVTGSSRGIGKAIALKLAAAGHDIALHYHSNQAAADASAAELRALGVNVSLLKFDVADRVAVRAALEADIEANGAYYGVVLNAGINRDNAFPAMSEAEWDSVIHTNLDGFYNVIHPCVMPMVQARKGGRIITLASVSGIAGNRGQVNYSASKAGLIGATKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVEQLVPMRRMGKPNEIAALAAFLMSDDAAYITRQVISVNGGMI
Hit FamilyFIG00028416
Hit Family Function3-oxoacyl-[ACP] reductase (EC 1.1.1.100)


back to search