Query Sequence
>203176
MRISLLQCQSSRDVSANLLFIESQLEELTQERQQWGDNSPHLVVLPECSLLFGGHESQQLAYAGDSHHSQLKSALSALATRYRVFMVAGTIPALAEGGRVYSRCYLFDDKGDTLGHYDKLHLFDVDVADGTKQYRESETFCPGDHISVIDTPFGKIGLSICYDLRFPDLFRAMRLAGAEIITVPSAFTKVTGEAHWQVLLQARAIETQCFIVAAAQWGAHNQGSRETWGQSMVIGPWGNIIAERKTGTGWVHADIDLTEVNSIRSKMPVMQHNRFNVPMIKR
Hit FamilyFIG01304250
Hit Family FunctionFIG003879: Predicted amidohydrolase / Aliphatic amidase AmiE (EC 3.5.1.4)


back to search