Query Sequence
>202809
MSDLSFLAKKRYTTKAFDPTKIIPTDKIADIKTLLQFSPSSTNSQPWHFVLAGTAEGKALIAQATEHYAFNTQKILDASHVVVLCTRTQLDEAHLLQVLEQEAKDGRFANEEAKQGQHNGRSFFANMHKFELKDAQHWMEKQVYLALGTLMLGASVLDIDACPIEGFDATKLNQVLGLREKGLCASVVVALGYRSEEDFNAKLPKSRLAQEVIFTEI
Hit FamilyFIG00731724
Hit Family FunctionOxygen-insensitive NAD(P)H nitroreductase (EC 1.-.-.-) / Dihydropteridine reductase (EC 1.5.1.34)


back to search