Query Sequence
>202808
MARLLMLIIALGLLPISSVYGKELKLALVPKFYSVFFDQSKNGCIDAAAQIEGVECIYRGPEISSVRLQDQVINQLIDEGVDGIAVAVTQSKYLVENSLKRAKEVGIPIVTYDSDFDASINGDPKNFRLAYIGTDNFELGKSLGEELKKLRPNGGMLIMQSGRPDSPNLNLRLMGVRSALSGKKYDIPPGKLLNNEQGWTEVREPLFNFDQLSQAVKQMESVMKGKPVKADSFIAVGGWAQNNDALYRDMIAPFQEKINDKEVVIVMTDTSPEQLTMLKDNLAHINVGQNPYEMGRQAILTLYKIVTKQQYEEVIYTPVTFCTPQNFNTCEKRAGM
Hit FamilyFIG01692595
Hit Family FunctionABC transporter, sugar-binding protein of unknown specificity


back to search