Query Sequence
>202450
MQEAQFIGLLWLIGILAEAMTGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPLVWVENVHYLIAIAFASLLTVAIAPVMRYLSKLFLAIDALGLAVFSIVGAQKTLMLGFSPTIAVVMGLVTGVFGGVIRDILCNQVPLIFKKELYAVISLFTAGLYITLNAYQLEEWINLVICLTLGFSLRMLALRYHWSMPTFDYQSSGDQHTH
Hit FamilyFIG00920505
Hit Family FunctionPutative inner membrane protein


back to search