Query Sequence
>202255
MKVLVPVKRVVDANVKVRVKADNTSVDTANLKMALNPFCEIAVEEAVRLKEAGSATEVVVVSIGNKAVQEQLRTALALGADRAIHIDTEEELAPVSIAKLLKAVQEKEQAQLVLFGKQSIDGDNNQTGQMFAALTDMPQATFASAIKVEGNSIQVAREIDGGMQTLSLPLPAVVTADLRLNEPRYASLPNIMKAKRKPLDVLTVADLGVTLKAHQTVVKVTPPAERKAGIMVASVAELVEKLKNEAKVI
Hit FamilyFIG01304886
Hit Family FunctionElectron transfer flavoprotein, beta subunit


back to search