Query Sequence
>202051
MSNVVSKNSAINVVNLEKSVTTQEGSLTILKGINLDVKQGESVAILGPSGSGKSTLLGLLAALDTPTAGEIWLDGEALSPLNEEQKAALRKQKVSFIFQSFMLVDTLTALENVMLPAELAGVKNAKEKAEAMLGRVGLSHRLTHLPKQLSGGEQQRVAIARAFICEPKVLFADEPTGNLDSVNGHKIADMLFELNQENHTTLILVTHDLQLAKRCQRQLVMDNGHLQENEHPNALQSNSACESNSITASAKEA
Hit FamilyFIG00007923
Hit Family FunctionABC transporter ATP-binding protein YvcR


back to search