Query Sequence
>200933
MRIFTVPEDADSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIETDFQTFEIPNQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGLNQNLVKIETSKAFTPLERQVLGMMHHLIYAQHDDFYRNWMHSANHSLGAFCSGGTVANITALWIARNQLLKADGDFKGVTREGLIKALRHYDYDDLAILVSERGHYSLGKAVDLLGIGRDNIISIPTDADNKVDVTQMRKIAVELAHKRIKVMAIVGVAGTTETGNIDPLKQLAALASELNCHFHVDAAWGGASLLSNKYRHLLDGVELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHAIAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAEQIDAHPDFELVTAPELCLLTYRYVPASVQAAMQVAIEQGDKAKLERFNEQLDGLTQFIQKHQREQGKSFVSRTRIQPARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIATLDKEFLPALLAMVAE
Hit FamilyFIG01327891
Hit Family FunctionGlutamate decarboxylase, eukaryotic type (EC 4.1.1.15)


back to search