Query Sequence
>200832
MTALTQMKCEACQADAPKVTDEELAELIRMIPDWGVQVRDGIMQLERVYKFKNFKLAMAFTNKLAELAEEEFHHPGILTEWGKVTVTWWSHSIKGLHKNDFIMAAKTDLLLD
Hit FamilyFIG00004933
Hit Family FunctionPterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)


back to search