Query Sequence
>200482
MSQKMAAEFLGTLWLVLGGCGSAVLAAAFPEVGIGLLGVSLAFGLTVLTMAFAIGHISGCHLNPAVSFGLWAGGRFPTSELLPYIIAQVAGGIAGAGVLYLIASGQEGFSLAAGFASNGFGEHSPGGYSMISVMICEIVMTLFFLLVILGSTDERAPKGFAPIAIGLCLTLIHLISIPISNTSVNPARSTGPALFVGDWAVSQLWLFWAAPIIGAILAGVIYRYFNAAK
Hit FamilyFIG00008396
Hit Family FunctionAquaporin Z


back to search