Query Sequence
>200482
MSQKMAAEFLGTLWLVLGGCGSAVLAAAFPEVGIGLLGVSLAFGLTVLTMAFAIGHISGCHLNPAVSFGLWAGGRFPTSELLPYIIAQVAGGIAGAGVLYLIASGQEGFSLAAGFASNGFGEHSPGGYSMISVMICEIVMTLFFLLVILGSTDERAPKGFAPIAIGLCLTLIHLISIPISNTSVNPARSTGPALFVGDWAVSQLWLFWAAPIIGAILAGVIYRYFNAAK
Hit FamilyFIG00008396
Hit Family Function


back to search