Query Sequence
>200162
MSSYDIAIIGGGISGVGIAQYAAAAGYSTLLIEKGEIGGQTSANSSKLIHGGLRYLESGQINLVRKSLLERRNLLDLAPSLVKPVAFYIPVYQDSRRNPLTIRAGLSLYALLSEFDPLGRFVSIPAVHWHRFKGLKLSGLKAVFQYWDAQTDDKLLTQAVARSAQALGAHIYAEAEFLQLNHLKEQIELSFRHRGEVQQIETKLVINAAGPWVNEVLAHVEPPLAGVEIDWVQGAHLLLDLPAPEGILYLESCFDKRVIFVMPWYGQMLIGTTETVLTSIDTPPQVTESETQYLLGIYCHYFPLSPSIEELKTKIVQTYCGVRVLPKQASSAFERPRDTLMQTSISHPRLLCLYGGKLTTFRSSSAEVLEWIEQKLGKRQPIADIDTLKLT
Hit FamilyFIG00043723
Hit Family FunctionAerobic glycerol-3-phosphate dehydrogenase (EC 1.1.5.3)


back to search